Rabbit Anti-Methyltransferase-like protein 10 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25803P

• Product Name:
• Rabbit Anti-Methyltransferase-like protein 10 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 151-200 (VDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAEL L) of Mouse Methyltransferase-like protein 10 (NP_082371).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Guinea pig, Cat, Dog, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid