Rabbit Anti-Methionyl Aminopeptidase 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25784P

• Product Name:
• Rabbit Anti-Methionyl Aminopeptidase 1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human Methionyl Aminopeptidase 1 aa 208-283. Sequence: RRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLM QAIDAVKPGVRYRELGNIIQKHAQAN

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Zebrafish, Orangutan, Xenopus tropicalis

• Isotype:
• IgG

• Application:
• IHC-P, WB, ICC/IF

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid