Rabbit Anti-Methionine Sulfoxide Reductase A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47584P

• Product Name:
• Rabbit Anti-Methionine Sulfoxide Reductase A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human Methionine Sulfoxide Reductase A aa 166-234. Sequence: AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKN PNGYCGLGGTGVSCPVGIK Database link: Q9UJ68 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• ICC/IF

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid