Rabbit Anti-Metallothionein Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25773P

• Product Name:
• Rabbit Anti-Metallothionein Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Human Metallothionein aa 1-61. Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCIC KGASDKCSCCA

• Species Reactivity:
• Mouse, Rat, Human Predicted to work with: Dog, Pig, Cynomolgus monkey, Orangutan

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: 0.1% Sodium azide Constituents: 49% PBS, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid