• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-MEPE Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-25675P
  • Product Name:
  • Rabbit Anti-MEPE Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within middle aa 350-399 (LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNE I) of Human MEPE (NP_064588).
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Storage Procedures:
  • After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-MEPCE Polyclonal Antibody-FPA-25674P
  • Online Inquiry

    refresh