Rabbit Anti-Measles Large Fusion Protein Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25484P

• Product Name:
• Rabbit Anti-Measles Large Fusion Protein Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Measles Large Fusion Protein aa 510-550 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: IPALICCCRGRCNKKGEQVGMSRPGLKPDLTGTSKSYVRSL

• Species Reactivity:
• Other

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 0.01% BSA, 50% Glycerol Aqueous buffered solution.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid