Rabbit Anti-MDM2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25463P

• Product Name:
• Rabbit Anti-MDM2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human MDM2 aa 393-424 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: DYSQPSTSSSIIYSSQEDVKEFEREETQDKEE

• Species Reactivity:
• Mouse, Rat, Cow, Dog, Human, African green monkey, Syrian hamster

• Isotype:
• IgG

• Application:
• ICC/IF, WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid