Rabbit Anti-MCP1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47565P

• Product Name:
• Rabbit Anti-MCP1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Equus MCP1 aa 24-99. Sequence: QPDAINSPVTCCYTFTGKKISSQRLGSYKRVTSSKCPKEAVIFKTILAKE ICADPEQKWVQDAVKQLDKKAQTPKP Database link: Q9TTQ3 Run BLAST with Run BLAST with

• Species Reactivity:
• Horse

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid