Rabbit Anti-MARCH3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25031P

• Product Name:
• Rabbit Anti-MARCH3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human MARCH3 aa 111-160. The exact sequence is proprietary. Sequence: SYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLAT

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS without Mg2+ and Ca2+.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid