Cat#:FPA-24779P;Product Name:Rabbit Anti-MAGEA8 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Fusion protein corresponding to Human MAGEA8 aa 1-318. Full length protein. The identity of the protein fusion partner is GST. BC002455. Sequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTL EEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPD PAHLES;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.3 Preservative: 0.05% Sodium azide Constituents: 50% Glycerol, 49% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Fusion protein corresponding to Human MAGEA8 aa 1-318. Full length protein. The identity of the protein fusion partner is GST. BC002455. Sequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTL EEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPD PAHLES