Cat#:FPA-24677P;Product Name:Rabbit Anti-Macrophage inflammatory protein 5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant full length protein corresponding to Human Macrophage inflammatory protein 5 aa 22-113. Expressed in E. coli. Sequence: QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYF ETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI ;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 49% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-Macrophage inflammatory protein 5 Polyclonal Antibody
Online Inquiry
Cat#:
FPA-24677P
Product Name:
Rabbit Anti-Macrophage inflammatory protein 5 Polyclonal Antibody
Host Species:
Rabbit
Immunogen:
Recombinant full length protein corresponding to Human Macrophage inflammatory protein 5 aa 22-113. Expressed in E. coli. Sequence: QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYF ETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI