Rabbit Anti-Macrophage Inflammatory Protein 1 beta Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-24655P

• Product Name:
• Rabbit Anti-Macrophage Inflammatory Protein 1 beta Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide: MKLCVSAFSLLLLVAAFCDSVLSAPIGSDPPTSCCFSYTSRKIHRNFVMD YYETSSLCSQPAVVFLTKK , corresponding to N terminal aa 1 - 69 of Rat Macrophage Inflammatory Protein 1 beta

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• IP, ICC/IF, Neutralising, WB

• Storage Buffer:
• Preservative: 0.1% Sodium Azide Constituents: PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid