Rabbit Anti-LRRC57 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-24361P

• Product Name:
• Rabbit Anti-LRRC57 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Fusion protein corresponding to Human LRRC57 aa 1-239. Full length fusion protein. The protein fusion partner is GST. Gene Accssion: BC058935. Sequence: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI ESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLREL

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• pH: 7.3 Preservative: 0.05% Sodium azide Constituents: 49% PBS, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid