Rabbit Anti-LRRC50 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-24356P

• Product Name:
• Rabbit Anti-LRRC50 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region of Human LRRC50. The immunogen is found within the following sequence which corresponds to aa 151-200 of the human protein: TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTL .

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB, ELISA, ICC/IF, IHC-P

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid