Cat#:FPA-24352P;Product Name:Rabbit Anti-LRRC47 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human LRRC47 aa 533-583 (C terminal). The exact sequence is proprietary. (NP_065761.1). Sequence: DPTTNPSAGKDGPSLLVVEQVRVVDLEGSLKVVYPSKADLATAPPHVTVV R ;Species Reactivity:Mouse, Human Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human LRRC47 aa 533-583 (C terminal). The exact sequence is proprietary. (NP_065761.1). Sequence: DPTTNPSAGKDGPSLLVVEQVRVVDLEGSLKVVYPSKADLATAPPHVTVV R
Species Reactivity:
Mouse, Human Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
Isotype:
IgG
Application:
WB, IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.