Rabbit Anti-LPCAT1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-24214P

• Product Name:
• Rabbit Anti-LPCAT1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to an internal region within aa 324-373 ( RLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFA ) of Human LPCAT1 (NP_079106)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• ICC/IF, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid