Rabbit Anti-LOC91614 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-24164P

• Product Name:
• Rabbit Anti-LOC91614 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human LOC91614 aa 461-511. The exact sequence is proprietary. NP_001070710.1. Sequence: SNNTEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFG D

• Species Reactivity:
• Human Predicted to work with: Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid