Rabbit Anti-LMTK3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-24070P

• Product Name:
• Rabbit Anti-LMTK3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse LMTK3 aa 1291-1340 (internal sequence). The exact sequence is proprietary. Immunogen located within 50 amino acid sequence Sequence: RGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQGT

• Species Reactivity:
• Mouse Predicted to work with: Guinea pig, Cow, Cat, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid