Rabbit Anti-LMAN1L Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-24041P

• Product Name:
• Rabbit Anti-LMAN1L Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human LMAN1L aa 325-374 (internal sequence). The exact sequence is proprietary. (NP_068591) Sequence: GLSKQLAQAERQWKKQLGPPGQARPDGGWALDASCQIPSTPGRGGHLSMS

• Species Reactivity:
• Human Predicted to work with: Horse

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid