Cat#:FPA-23916P;Product Name:Rabbit Anti-Lipase 3 Polyclonal Antibody;Formulation:Lyophilised:Reconstituted by adding 1.0 ml sterile distilled water. Spin down to remove insoluble particles.;Host Species:Rabbit ;Immunogen:Full length native protein (purified) corresponding to Lipase 3 aa 16-549. (Isolated and purified from Candida cylindracea). Sequence: APTAKLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLNG QKFTSYGPSCMQQNPEGTFEENLGKTALDLVMQSKVFQAVLPQSEDCLTI NVVRPPGTKAGANLPVML;Species Reactivity:Other;Isotype:IgG;Application:ICC, IHC-P, WB, Dot blot;Storage Buffer:pH: 7.20 Constituent: 100% PBS No preservative added. No foreign protein added.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. Store In the Dark.;
Lyophilised:Reconstituted by adding 1.0 ml sterile distilled water. Spin down to remove insoluble particles.
Host Species:
Rabbit
Immunogen:
Full length native protein (purified) corresponding to Lipase 3 aa 16-549. (Isolated and purified from Candida cylindracea). Sequence: APTAKLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLNG QKFTSYGPSCMQQNPEGTFEENLGKTALDLVMQSKVFQAVLPQSEDCLTI NVVRPPGTKAGANLPVML
Species Reactivity:
Other
Isotype:
IgG
Application:
ICC, IHC-P, WB, Dot blot
Storage Buffer:
pH: 7.20 Constituent: 100% PBS No preservative added. No foreign protein added.
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. Store In the Dark.