• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Lipase 3 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-23916P
  • Product Name:
  • Rabbit Anti-Lipase 3 Polyclonal Antibody
  • Formulation:
  • Lyophilised:Reconstituted by adding 1.0 ml sterile distilled water. Spin down to remove insoluble particles.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Full length native protein (purified) corresponding to Lipase 3 aa 16-549. (Isolated and purified from Candida cylindracea). Sequence: APTAKLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLNG QKFTSYGPSCMQQNPEGTFEENLGKTALDLVMQSKVFQAVLPQSEDCLTI NVVRPPGTKAGANLPVML
  • Species Reactivity:
  • Other
  • Isotype:
  • IgG
  • Application:
  • ICC, IHC-P, WB, Dot blot
  • Storage Buffer:
  • pH: 7.20 Constituent: 100% PBS No preservative added. No foreign protein added.
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. Store In the Dark.
  • Clonality:
  • Polyclonal
  • Pre product:Rabbit Anti-LIPA3 Polyclonal Antibody-FPA-23915P
  • Online Inquiry

    refresh