Rabbit Anti-LINGO4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23910P

• Product Name:
• Rabbit Anti-LINGO4 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within aa 468-517 (TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNI T) of human LINGO4 (NP_001004432).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid