Rabbit Anti-LIM domain-binding protein 1-A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47461P

• Product Name:
• Rabbit Anti-LIM domain-binding protein 1-A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Zebrafish LIM domain-binding protein 1-A aa 336-368 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: DDEDSFNSSPTMGTNSPWNSKAPSSQQGKNDNP Database link: O73715 Run BLAST with R

• Species Reactivity:
• Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid