Rabbit Anti-LHFPL3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23770P

• Product Name:
• Rabbit Anti-LHFPL3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse LHFPL3 aa 130-179 (C terminal). The exact sequence is proprietary. Sequence: TATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGA

• Species Reactivity:
• Mouse Predicted to work with: Horse, Chicken, Guinea pig, Cow, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid