Cat#:FPA-23724P;Product Name:Rabbit Anti-Leucyl-cystinyl aminopeptidase Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Leucyl-cystinyl aminopeptidase aa 1-50 (N terminal). The exact sequence is proprietary. NP_005566.2. Sequence: MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRG ;Species Reactivity:Human Predicted to work with: Horse, Pig, Chimpanzee, Rhesus monkey, Common marmoset;Isotype:IgG;Application:IP, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Leucyl-cystinyl aminopeptidase aa 1-50 (N terminal). The exact sequence is proprietary. NP_005566.2. Sequence: MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRG
Species Reactivity:
Human Predicted to work with: Horse, Pig, Chimpanzee, Rhesus monkey, Common marmoset
Isotype:
IgG
Application:
IP, WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: