• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-LC3C Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-23570P
  • Product Name:
  • Rabbit Anti-LC3C Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide conjugated to KLH, corresponding to aa 1-30 (MPPPQKIPSVRPFKQRKSLAIRQEEVAGIR) of Human LC3C (UniProt ID: Q9BXW4).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituent: 100% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-LC3B Polyclonal Antibody-FPA-23569P
  • Online Inquiry

    refresh