Rabbit Anti-LBX1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23560P

• Product Name:
• Rabbit Anti-LBX1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region of Human LBX1 within internal sequence aa 72-121 ( PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQT ) (NP_006553)

• Species Reactivity:
• Human, Zebrafish Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Xenopus laevis

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid