Rabbit Anti-LAMP2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23447P

• Product Name:
• Rabbit Anti-LAMP2 Polyclonal Antibody

• Formulation:
• Alternative splicing produces 3 isoforms.

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human LAMP2 aa 305-355 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: LVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQP F

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 0.01% BSA, 50% Glycerol Aqueous buffered solution.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal