Rabbit Anti-L3MBTL4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23352P

• Product Name:
• Rabbit Anti-L3MBTL4 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the N terminal aa 36-85 ( STTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQSFPEHENGFQ ) of Human L3MBTL4, NP_775735.

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid