Rabbit Anti-Kv2.1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23309P

• Product Name:
• Rabbit Anti-Kv2.1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within internal sequence aa 755-804 (IDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT S) of Human KCNB1 (NP_004966)

• Species Reactivity:
• Human Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid