Rabbit Anti-KRTAP24-1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23249P

• Product Name:
• Rabbit Anti-KRTAP24-1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the internal aa 205-254 (VRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC Y) of human KRTAP24-1 (NP_001078924).

• Species Reactivity:
• Human Predicted to work with: Rat, Horse, Cat

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid