Rabbit Anti-KPNA4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23168P

• Product Name:
• Rabbit Anti-KPNA4 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human KPNA4 aa 471-521 (C terminal). The exact sequence is proprietary. (NP_002259.1). Sequence: EDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQ F

• Species Reactivity:
• Human Predicted to work with: Rabbit, Horse, Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP, IHC-P, ICC/IF

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 99% Tris buffered saline, 0.1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid