Rabbit Anti-KLHL4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-23064P

• Product Name:
• Rabbit Anti-KLHL4 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region within N-terminal aa 36-85 ( LQQEGYEHRGTPVQGRLKSHSRDRNGLKKSNSPVHHNILAPVPGPAPAHQ ) of Human KLHL4 (NP_061990)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid