Cat#:FPA-22855P;Product Name:Rabbit Anti-KIF5B Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human KIF5B aa 913-963 (C terminal). The exact sequence is proprietary. (NP_004512.1) Sequence: RRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGGKQ V ;Species Reactivity:Human Predicted to work with: Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan;Isotype:IgG;Application:IP, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human KIF5B aa 913-963 (C terminal). The exact sequence is proprietary. (NP_004512.1) Sequence: RRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGGKQ V
Species Reactivity:
Human Predicted to work with: Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
Isotype:
IgG
Application:
IP, WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.