Rabbit Anti-KIAA1024 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-22703P

• Product Name:
• Rabbit Anti-KIAA1024 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C terminal aa 755-804 (DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKA H) of Human KIAA1024 (NP_056021).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid