Rabbit Anti-KIAA0895L Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47360P

• Product Name:
• Rabbit Anti-KIAA0895L Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human KIAA0895L aa 421-471 (C terminal). Sequence: EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLP D Database link: Q68EN5 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: PBS, 40% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid