Cat#:FPA-22599P;Product Name:Rabbit Anti-KDM6A / UTX Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human KDM6A/ UTX aa 1352-1401 (C terminal). Sequence: KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;