Cat#:FPA-22540P;Product Name:Rabbit Anti-KCTD6 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human KCTD6 aa 168-237 (C terminal). Sequence: MDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERA NENTVEHNWTFCRLARKTDD ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Zebrafish;Isotype:IgG;Application:WB, ICC/IF, IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Recombinant fragment corresponding to Human KCTD6 aa 168-237 (C terminal). Sequence: MDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERA NENTVEHNWTFCRLARKTDD
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Zebrafish