Cat#:FPA-22533P;Product Name:Rabbit Anti-KCTD21 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide, corresponding to a region within internal sequence aa 37-86 PTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLR;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:WB, ELISA;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;