• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-KCNQ1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-22479P
  • Product Name:
  • Rabbit Anti-KCNQ1 Polyclonal Antibody
  • Formulation:
  • There are 2 isoforms produced by alternative splicing. Isoform 2 also known as: TKvLQT1.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human KCNQ1 aa 519-549 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: RMQYFVAKKKFQQARKPYDVRDVIEQYSQGH
  • Species Reactivity:
  • Mouse, Human
  • Isotype:
  • IgG
  • Application:
  • WB, Flow Cyt, IHC-P
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituent: 99% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Pre product:Rabbit Anti-KCNN4 Polyclonal Antibody-FPA-22478P
  • Online Inquiry

    refresh