Rabbit Anti-KCNQ1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-22479P

• Product Name:
• Rabbit Anti-KCNQ1 Polyclonal Antibody

• Formulation:
• There are 2 isoforms produced by alternative splicing. Isoform 2 also known as: TKvLQT1.

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human KCNQ1 aa 519-549 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: RMQYFVAKKKFQQARKPYDVRDVIEQYSQGH

• Species Reactivity:
• Mouse, Human

• Isotype:
• IgG

• Application:
• WB, Flow Cyt, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal