Rabbit Anti-KCNK9 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-22461P

• Product Name:
• Rabbit Anti-KCNK9 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N-terminal aa 36-85 ( REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY ) of human KCNK9 (NP_057685)

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid