Cat#:FPA-22173P;Product Name:Rabbit Anti-Junctophilin-2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within N terminal aa 66-115 ( QGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQ ) of Mouse Junctophilin-2 (NP_067541). ;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.;
Synthetic peptide corresponding to a region within N terminal aa 66-115 ( QGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQ ) of Mouse Junctophilin-2 (NP_067541).
Species Reactivity:
Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 98% PBS, 2% Sucrose
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.