Cat#:FPA-22105P;Product Name:Rabbit Anti-JMJD5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human JMJD5 aa 288-337 (internal sequence). Sequence: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:ChIP, WB;Storage Buffer:Constituents: 2% Sucrose, PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid repeated freeze/thaw cycles.;