Rabbit Anti-IQCK Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-21756P

• Product Name:
• Rabbit Anti-IQCK Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within internal sequence aa 144-193 ( MASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIP ) of Human IQCK (NP_694940)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid