Rabbit Anti-Interferon gamma Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-21635P

• Product Name:
• Rabbit Anti-Interferon gamma Polyclonal Antibody

• Formulation:
• Lyophilised:Reconstitute with 200µl of sterile water.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Human Interferon gamma. Mature Interferon gamma is from aa 24-161 of SwissProt ID Q14609. aa 1-23 represents the signal peptide. Sequence: MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQI VSFYFKLFKN FKDDQ

• Species Reactivity:
• Human, Macaque monkey

• Isotype:
• IgG

• Application:
• WB, ELISA, Neutralising, ICC/IF, IHC-P

• Storage Buffer:
• PBS, pH 7.4, no preservative, sterile filtered

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal