Rabbit Anti-Integrin beta 1 + Integrin alpha 3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-21574P

• Product Name:
• Rabbit Anti-Integrin beta 1 + Integrin alpha 3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• This product was produced with the following immunogens: Synthetic peptide within Human Integrin alpha 3 aa 976-1025 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: VDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTR

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• ICC/IF, WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid