Cat#:FPA-21545P;Product Name:Rabbit Anti-Integrin alpha 3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human Integrin alpha 3 aa 500-550. Sequence: NQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMR C ;Species Reactivity:Mouse, Human Predicted to work with: Cow, Chinese hamster;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.2 Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;