Rabbit Anti-Insig2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-21500P

• Product Name:
• Rabbit Anti-Insig2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region within aa 72-121 ( WVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHA ) of Human Insig2 (NP_057217)

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid