Rabbit Anti-INO80C Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-21468P

• Product Name:
• Rabbit Anti-INO80C Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human INO80C aa 8-57 (N terminal). The exact sequence is proprietary. Sequence: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid