Cat#:FPA-21134P;Product Name:Rabbit Anti-IL2 Receptor gamma Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human IL2 Receptor gamma aa 220-260. Sequence: TFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFAL ;Species Reactivity:Human Predicted to work with: Dog;Isotype:IgG;Application:ICC/IF;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;