Cat#:FPA-21194P;Product Name:Rabbit Anti-IL28A Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human IL28A aa 131-180 (C terminal). The exact sequence is proprietary. Sequence: HHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTF ;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 49% PBS, 0.87% Sodium chloride PBS without Mg2+ and Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human IL28A aa 131-180 (C terminal). The exact sequence is proprietary. Sequence: HHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTF
Species Reactivity:
Human
Isotype:
IgG
Application:
WB
Storage Buffer:
pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 49% PBS, 0.87% Sodium chloride PBS without Mg2+ and Ca2+
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: